BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs6855 1513030 1513215 62 !not a gene! (62 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71160 hypothetical protein PH0485 - Pyrococcus horikoshii ... 85 1e-16 >pir||H71160 hypothetical protein PH0485 - Pyrococcus horikoshii >gi|3256890|dbj|BAA29573.1| (AP000002) 307aa long hypothetical protein [Pyrococcus horikoshii] Length = 307 Score = 84.7 bits (206), Expect = 1e-16 Identities = 44/61 (72%), Positives = 47/61 (76%) Query: 1 MTFSSSSFGRSEETLNSITSLSRFPLSITSRPGFVQITSPLSSKSERIRNALTPFRGASF 60 MT SSSS G S LNS TS SR P S+ S PGFVQITSPLSS+SE IR ALTPF+GASF Sbjct: 242 MTVSSSSLGVSLTILNSTTSPSRLPFSMISLPGFVQITSPLSSRSESIRKALTPFKGASF 301 Query: 61 W 61 W Sbjct: 302 W 302 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.127 0.354 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18920212 Number of Sequences: 2977 Number of extensions: 471930 Number of successful extensions: 1283 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1281 Number of HSP's gapped (non-prelim): 2 length of query: 62 length of database: 189,106,746 effective HSP length: 41 effective length of query: 21 effective length of database: 164,568,779 effective search space: 3455944359 effective search space used: 3455944359 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)