BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs6938 1540931 1541224 98 !not a gene! (98 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71156 hypothetical protein PH0454 - Pyrococcus horikoshii ... 177 3e-44 >pir||G71156 hypothetical protein PH0454 - Pyrococcus horikoshii >gi|3256857|dbj|BAA29540.1| (AP000002) 135aa long hypothetical protein [Pyrococcus horikoshii] Length = 135 Score = 177 bits (444), Expect = 3e-44 Identities = 89/97 (91%), Positives = 91/97 (93%) Query: 1 MSYLLMSSPLYLFIIAETFSTASLAISPSFPVTIILPSSLLAAGATIASIGNTIPLCSPI 60 MSYLL+SSPLYLFIIAET TAS AISPSFPVTIILPSSLLAAGATIASIG TIPLCSPI Sbjct: 1 MSYLLISSPLYLFIIAETLRTASFAISPSFPVTIILPSSLLAAGATIASIGKTIPLCSPI 60 Query: 61 IAKPLTLPISPPSVLITWYSFFLSMYQSASCFSSGLA 97 IAKP TLPISPPS LITWYSFFLSMYQSASCFS+GLA Sbjct: 61 IAKPFTLPISPPSTLITWYSFFLSMYQSASCFSNGLA 97 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.135 0.395 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33562816 Number of Sequences: 2977 Number of extensions: 1209890 Number of successful extensions: 5399 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5398 Number of HSP's gapped (non-prelim): 1 length of query: 98 length of database: 189,106,746 effective HSP length: 52 effective length of query: 46 effective length of database: 157,985,422 effective search space: 7267329412 effective search space used: 7267329412 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 159 (66.3 bits)