BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs7354 1670867 1671025 53 !not a gene! (53 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O26368|R27A_METTH 30S RIBOSOMAL PROTEIN S27AE >gi|7439606|pir... 88 1e-17 emb|CAC12221.1| (AL445066) probable 30S ribosomal protein S27A [... 86 4e-17 gi|11498713 SSU ribosomal protein S27AE (rps27AE) [Archaeoglobus... 76 3e-14 sp|P54031|R27A_METJA 30S RIBOSOMAL PROTEIN S27AE >gi|2129267|pir... 75 8e-14 >sp|O26368|R27A_METTH 30S RIBOSOMAL PROTEIN S27AE >gi|7439606|pir||G69133 ribosomal protein S27a - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2621318|gb|AAB84774.1| (AE000812) ribosomal protein S27a [Methanobacterium thermoautotrophicum] Length = 51 Score = 88.2 bits (215), Expect = 1e-17 Identities = 35/49 (71%), Positives = 43/49 (87%) Query: 5 QKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKKK 53 +K++LY VKDGK++RKN FC RC GVFMADHGDR+ACG+CGYTEWK + Sbjct: 2 KKFELYEVKDGKLVRKNPFCVRCSNGVFMADHGDRYACGKCGYTEWKNR 50 >emb|CAC12221.1| (AL445066) probable 30S ribosomal protein S27A [Thermoplasma acidophilum] Length = 55 Score = 86.2 bits (210), Expect = 4e-17 Identities = 33/48 (68%), Positives = 44/48 (90%) Query: 5 QKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKK 52 QK +LY + DGK++RK++FCPRCGPGVF+A+H DR++CGRCGYTE+KK Sbjct: 2 QKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKK 49 >gi|11498713 SSU ribosomal protein S27AE (rps27AE) [Archaeoglobus fulgidus] >gi|7388044|sp|O29152|R27A_ARCFU 30S RIBOSOMAL PROTEIN S27AE >gi|7439604|pir||H69388 SSU ribosomal protein S27AE (rps27AE) homolog - Archaeoglobus fulgidus >gi|2649484|gb|AAB90138.1| (AE001027) SSU ribosomal protein S27AE (rps27AE) [Archaeoglobus fulgidus] Length = 55 Score = 76.5 bits (185), Expect = 3e-14 Identities = 30/47 (63%), Positives = 39/47 (82%) Query: 7 WKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKKK 53 ++ Y +K KV+RK KFCPRCG GVF+A+H DR +CG+CGYTE+KKK Sbjct: 9 YRYYEIKGEKVVRKKKFCPRCGEGVFLAEHKDRLSCGKCGYTEFKKK 55 >sp|P54031|R27A_METJA 30S RIBOSOMAL PROTEIN S27AE >gi|2129267|pir||A64349 ribosomal protein S27A - Methanococcus jannaschii >gi|1591098|gb|AAB98383.1| (U67492) SSU ribosomal protein S27AE [Methanococcus jannaschii] Length = 60 Score = 75.3 bits (182), Expect = 8e-14 Identities = 30/47 (63%), Positives = 38/47 (80%) Query: 6 KWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKK 52 K+K Y ++ KVIR K CPRCGPGVFMA+H +R+ACG+CGY EWK+ Sbjct: 9 KYKYYKIEGDKVIRLKKTCPRCGPGVFMAEHLNRYACGKCGYMEWKQ 55 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.145 0.543 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25593624 Number of Sequences: 2977 Number of extensions: 772147 Number of successful extensions: 2461 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2457 Number of HSP's gapped (non-prelim): 4 length of query: 53 length of database: 189,106,746 effective HSP length: 32 effective length of query: 21 effective length of database: 169,955,162 effective search space: 3569058402 effective search space used: 3569058402 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 156 (65.2 bits)