BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs7875 1694001 1693723 -93 !not a gene! (93 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71209 hypothetical protein PH1944 - Pyrococcus horikoshii ... 104 2e-22 >pir||H71209 hypothetical protein PH1944 - Pyrococcus horikoshii >gi|3258388|dbj|BAA31071.1| (AP000007) 107aa long hypothetical protein [Pyrococcus horikoshii] Length = 107 Score = 104 bits (257), Expect = 2e-22 Identities = 51/67 (76%), Positives = 53/67 (78%) Query: 27 EWHLPQMGALFSINFSISSRYPGTSTNRVSSRNFSLLMWGSLAVIGTTSKPAHLSIFTVA 86 EWHLP MGALFSI+ ISS YPGTSTN VSS NF +WGS AVIG TS PAHL I TVA Sbjct: 21 EWHLPHMGALFSISLFISSIYPGTSTNTVSSSNFDQSIWGSFAVIGITSNPAHLRILTVA 80 Query: 87 ELSLPPE 93 ELSLPPE Sbjct: 81 ELSLPPE 87 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.129 0.386 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25498601 Number of Sequences: 2977 Number of extensions: 676050 Number of successful extensions: 1410 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1409 Number of HSP's gapped (non-prelim): 1 length of query: 93 length of database: 189,106,746 effective HSP length: 53 effective length of query: 40 effective length of database: 157,386,935 effective search space: 6295477400 effective search space used: 6295477400 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 158 (66.0 bits)