BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs7878 1693423 1693142 -94 !not a gene! (94 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B72477 hypothetical protein APE2459 - Aeropyrum pernix (str... 81 3e-15 >pir||B72477 hypothetical protein APE2459 - Aeropyrum pernix (strain K1) >gi|5106163|dbj|BAA81474.1| (AP000064) 117aa long hypothetical protein [Aeropyrum pernix] Length = 117 Score = 80.8 bits (196), Expect = 3e-15 Identities = 48/94 (51%), Positives = 56/94 (59%) Query: 1 MYLAFLSLLAGAPVFIWPAFSATAKSAIVASSVSPLLWETTTPYPALNAMYAASIASVNV 60 +Y LS AGAPV I A ATA+SA+ SSVSPLLW T P A + AS ASV V Sbjct: 9 LYFEVLSPRAGAPVLIIKASVATARSAMKVSSVSPLLWLTMWTIPLSLAAWMASRASVRV 68 Query: 61 PIWLTFKSRAFAAPISIPFFSLFGFVTKRSSPTI 94 P W TF R A + +L+G VT+RSSPTI Sbjct: 69 PTWFTFTRRPVTALRAEASLTLWGLVTRRSSPTI 102 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.132 0.407 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31519725 Number of Sequences: 2977 Number of extensions: 1011101 Number of successful extensions: 3664 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3663 Number of HSP's gapped (non-prelim): 1 length of query: 94 length of database: 189,106,746 effective HSP length: 50 effective length of query: 44 effective length of database: 159,182,396 effective search space: 7004025424 effective search space used: 7004025424 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 158 (66.0 bits)