BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs7927 1680644 1680369 -92 !not a gene! (92 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71207 hypothetical protein PH1924 - Pyrococcus horikoshii ... 143 3e-34 >pir||D71207 hypothetical protein PH1924 - Pyrococcus horikoshii >gi|3258368|dbj|BAA31051.1| (AP000007) 124aa long hypothetical protein [Pyrococcus horikoshii] Length = 124 Score = 143 bits (358), Expect = 3e-34 Identities = 70/91 (76%), Positives = 77/91 (83%) Query: 1 MAFAVPSSSTWETYVMGFPWNSSPRVSIIFSFMYFTIIMNSSTNGSRFSSMYSIMGLLAT 60 +A AVPSSS W TYV+GFPWNSSPRVSIIFSF+Y T I+NSSTNGSRFSSMYSI+GL A Sbjct: 33 IALAVPSSSPWTTYVIGFPWNSSPRVSIIFSFLYLTTIINSSTNGSRFSSMYSIIGLFAI 92 Query: 61 FKIGFGLSSVSGLNLSPFPAARTTAFILSHP 91 FKIG GLSSV GL+LSPFPAA TAF+ P Sbjct: 93 FKIGLGLSSVKGLSLSPFPAASITAFMTLPP 123 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.132 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32753593 Number of Sequences: 2977 Number of extensions: 1055518 Number of successful extensions: 3280 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3279 Number of HSP's gapped (non-prelim): 1 length of query: 92 length of database: 189,106,746 effective HSP length: 51 effective length of query: 41 effective length of database: 158,583,909 effective search space: 6501940269 effective search space used: 6501940269 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 158 (66.0 bits)