BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs8013 1660086 1659826 -87 !not a gene! (87 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71454 hypothetical protein PH0291 - Pyrococcus horikoshii ... 119 4e-27 >pir||D71454 hypothetical protein PH0291 - Pyrococcus horikoshii >gi|3256680|dbj|BAA29363.1| (AP000001) 116aa long hypothetical protein [Pyrococcus horikoshii] Length = 116 Score = 119 bits (296), Expect = 4e-27 Identities = 64/87 (73%), Positives = 68/87 (77%) Query: 1 MNNSSASGKTSSGFPFISIRLRTFSMPFSSRPNSPSALRNSSWDSLSFLSIILINPMSSL 60 +NNSSA GKT SG PFIS TFS+ S +PNS S L NSSWDSLS LSIILINPMSS Sbjct: 30 LNNSSAKGKTLSGLPFISTSSSTFSISLSPKPNSLSKLMNSSWDSLSLLSIILINPMSSD 89 Query: 61 TPSIFANSSRRTLSPILTVKSFSPVER 87 TPSI ANSSRR LSP+LTVKS PVER Sbjct: 90 TPSIPANSSRRILSPMLTVKSLRPVER 116 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.126 0.350 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30084320 Number of Sequences: 2977 Number of extensions: 971975 Number of successful extensions: 2591 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2590 Number of HSP's gapped (non-prelim): 1 length of query: 87 length of database: 189,106,746 effective HSP length: 57 effective length of query: 30 effective length of database: 154,992,987 effective search space: 4649789610 effective search space used: 4649789610 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 157 (65.6 bits)