BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs8046 1647973 1647869 -35 !not a gene! (35 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71455 hypothetical protein PH0301 - Pyrococcus horikoshii ... 67 2e-11 >pir||G71455 hypothetical protein PH0301 - Pyrococcus horikoshii >gi|3256691|dbj|BAA29374.1| (AP000001) 128aa long hypothetical protein [Pyrococcus horikoshii] Length = 128 Score = 67.1 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Query: 1 MWRGAPISSHCFFAYSSLFFEYSPMPRFMWRHSML 35 +WRGAPIS HCFFAYSSLF EY +PRFMWRHS+L Sbjct: 94 IWRGAPISLHCFFAYSSLFSEYPLIPRFMWRHSIL 128 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.336 0.139 0.535 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14262441 Number of Sequences: 2977 Number of extensions: 292728 Number of successful extensions: 783 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 782 Number of HSP's gapped (non-prelim): 1 length of query: 35 length of database: 189,106,746 effective HSP length: 14 effective length of query: 21 effective length of database: 180,727,928 effective search space: 3795286488 effective search space used: 3795286488 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 39 (21.8 bits) S2: 156 (65.2 bits)