BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs8046 1647973 1647869 -35 !not a gene!
         (35 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||G71455 hypothetical protein PH0301 - Pyrococcus horikoshii ...    67  2e-11

>pir||G71455 hypothetical protein PH0301 - Pyrococcus horikoshii
           >gi|3256691|dbj|BAA29374.1| (AP000001) 128aa long
           hypothetical protein [Pyrococcus horikoshii]
           Length = 128
           
 Score = 67.1 bits (161), Expect = 2e-11
 Identities = 28/35 (80%), Positives = 31/35 (88%)

Query: 1   MWRGAPISSHCFFAYSSLFFEYSPMPRFMWRHSML 35
           +WRGAPIS HCFFAYSSLF EY  +PRFMWRHS+L
Sbjct: 94  IWRGAPISLHCFFAYSSLFSEYPLIPRFMWRHSIL 128


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.336    0.139    0.535 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14262441
Number of Sequences: 2977
Number of extensions: 292728
Number of successful extensions: 783
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 782
Number of HSP's gapped (non-prelim): 1
length of query: 35
length of database: 189,106,746
effective HSP length: 14
effective length of query: 21
effective length of database: 180,727,928
effective search space: 3795286488
effective search space used: 3795286488
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 39 (21.8 bits)
S2: 156 (65.2 bits)