BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs8214 1584780 1584613 -56 !not a gene! (56 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71142 hypothetical protein PH0352 - Pyrococcus horikoshii ... 101 8e-22 >pir||E71142 hypothetical protein PH0352 - Pyrococcus horikoshii >gi|3256743|dbj|BAA29426.1| (AP000002) 107aa long hypothetical protein [Pyrococcus horikoshii] Length = 107 Score = 101 bits (250), Expect = 8e-22 Identities = 48/56 (85%), Positives = 53/56 (93%) Query: 1 MIVTGIATKSPAIGPLTPRSTSAFLVGIGDLTLITAPRVPIKDGNGMKYGNVDLTL 56 +IVTGIATKSPAIGPL P+ST+AFLVGIGD TLITAP VP+K+GNGMKYGNVDLTL Sbjct: 8 IIVTGIATKSPAIGPLAPKSTAAFLVGIGDFTLITAPSVPMKEGNGMKYGNVDLTL 63 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.140 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20871634 Number of Sequences: 2977 Number of extensions: 651400 Number of successful extensions: 1242 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1241 Number of HSP's gapped (non-prelim): 1 length of query: 56 length of database: 189,106,746 effective HSP length: 35 effective length of query: 21 effective length of database: 168,159,701 effective search space: 3531353721 effective search space used: 3531353721 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 156 (65.2 bits)