BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs8254 1574061 1573927 -45 !not a gene! (45 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71144 hypothetical protein PH0364 - Pyrococcus horikoshii ... 86 4e-17 >pir||A71144 hypothetical protein PH0364 - Pyrococcus horikoshii >gi|3256755|dbj|BAA29438.1| (AP000002) 173aa long hypothetical protein [Pyrococcus horikoshii] Length = 173 Score = 86.2 bits (210), Expect = 4e-17 Identities = 39/41 (95%), Positives = 39/41 (95%) Query: 1 MNFSMSGCQISKIPIFAPLLTPPCFITSLTASMRCMNETGP 41 MNFSMSGC IS IPIFAPLLTPPCFITSLTASMRCMNETGP Sbjct: 18 MNFSMSGCHISSIPIFAPLLTPPCFITSLTASMRCMNETGP 58 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.138 0.438 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15675817 Number of Sequences: 2977 Number of extensions: 342868 Number of successful extensions: 804 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 803 Number of HSP's gapped (non-prelim): 1 length of query: 45 length of database: 189,106,746 effective HSP length: 24 effective length of query: 21 effective length of database: 174,743,058 effective search space: 3669604218 effective search space used: 3669604218 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 156 (65.2 bits)