BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs8254 1574061 1573927 -45 !not a gene!
         (45 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||A71144 hypothetical protein PH0364 - Pyrococcus horikoshii ...    86  4e-17

>pir||A71144 hypothetical protein PH0364 - Pyrococcus horikoshii
          >gi|3256755|dbj|BAA29438.1| (AP000002) 173aa long
          hypothetical protein [Pyrococcus horikoshii]
          Length = 173
          
 Score = 86.2 bits (210), Expect = 4e-17
 Identities = 39/41 (95%), Positives = 39/41 (95%)

Query: 1  MNFSMSGCQISKIPIFAPLLTPPCFITSLTASMRCMNETGP 41
          MNFSMSGC IS IPIFAPLLTPPCFITSLTASMRCMNETGP
Sbjct: 18 MNFSMSGCHISSIPIFAPLLTPPCFITSLTASMRCMNETGP 58


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.327    0.138    0.438 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15675817
Number of Sequences: 2977
Number of extensions: 342868
Number of successful extensions: 804
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 803
Number of HSP's gapped (non-prelim): 1
length of query: 45
length of database: 189,106,746
effective HSP length: 24
effective length of query: 21
effective length of database: 174,743,058
effective search space: 3669604218
effective search space used: 3669604218
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.7 bits)
S2: 156 (65.2 bits)