BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs8580 1478698 1478501 -66 !not a gene! (66 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71166 hypothetical protein PH0529 - Pyrococcus horikoshii ... 81 2e-15 >pir||E71166 hypothetical protein PH0529 - Pyrococcus horikoshii >gi|3256935|dbj|BAA29618.1| (AP000002) 174aa long hypothetical protein [Pyrococcus horikoshii] Length = 174 Score = 80.8 bits (196), Expect = 2e-15 Identities = 41/60 (68%), Positives = 45/60 (74%) Query: 5 SPHSXXXXXXXXXXXGWVRTLLFVLTITQTGTRLFCFMAFASLSFFAKGLFLAIFIPSQE 64 SPHS G V+TLLFVLTITQTGT LFCFMA ASLSFFA+GLFLAI +PSQ+ Sbjct: 115 SPHSLSFVLLQCLLFGCVKTLLFVLTITQTGTLLFCFMALASLSFFARGLFLAISLPSQD 174 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.333 0.139 0.426 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15708719 Number of Sequences: 2977 Number of extensions: 328623 Number of successful extensions: 1126 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1125 Number of HSP's gapped (non-prelim): 1 length of query: 66 length of database: 189,106,746 effective HSP length: 45 effective length of query: 21 effective length of database: 162,174,831 effective search space: 3405671451 effective search space used: 3405671451 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 39 (21.6 bits) S2: 156 (65.2 bits)