BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs8831 1396110 1395835 -92 !not a gene! (92 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71104 hypothetical protein PH0607 - Pyrococcus horikoshii ... 132 7e-31 >pir||F71104 hypothetical protein PH0607 - Pyrococcus horikoshii >gi|3257013|dbj|BAA29696.1| (AP000003) 120aa long hypothetical protein [Pyrococcus horikoshii] Length = 120 Score = 132 bits (330), Expect = 7e-31 Identities = 66/91 (72%), Positives = 72/91 (78%) Query: 2 GVTTSLSPLLTLRMCLAIXXXXXXXXXXTRTKMRSNLLIKVGGKFICSDILFILLNLPCF 61 GVTTSLSPLLT +CLAI RTK++SNLL VGG+ ICSD LFILLNLPCF Sbjct: 12 GVTTSLSPLLTFNICLAISLSTFSSGSSMRTKIKSNLLSNVGGRSICSDTLFILLNLPCF 71 Query: 62 GFAAAMTVVLAFRVAVIPAFDRLIVCCSNAS 92 GFAAA+TVVLAF VAV+PAFDRLIVCCS AS Sbjct: 72 GFAAAITVVLAFSVAVMPAFDRLIVCCSRAS 102 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.336 0.144 0.436 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24509388 Number of Sequences: 2977 Number of extensions: 679557 Number of successful extensions: 1554 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1553 Number of HSP's gapped (non-prelim): 1 length of query: 92 length of database: 189,106,746 effective HSP length: 47 effective length of query: 45 effective length of database: 160,977,857 effective search space: 7244003565 effective search space used: 7244003565 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 39 (21.7 bits) S2: 159 (66.3 bits)