BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs8931 1366590 1366327 -88 !not a gene! (88 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71172 hypothetical protein PH0573 - Pyrococcus horikoshii ... 107 3e-23 >pir||A71172 hypothetical protein PH0573 - Pyrococcus horikoshii >gi|3256979|dbj|BAA29662.1| (AP000002) 141aa long hypothetical protein [Pyrococcus horikoshii] Length = 141 Score = 107 bits (264), Expect = 3e-23 Identities = 59/88 (67%), Positives = 59/88 (67%) Query: 1 MLGFIPVAKITRSALYSPASVTTFSTLSFPSILRTISWSLRXXXXXXXXXXXXXXXXXKD 60 M GFIPVAKIT SALYSPASVTTFSTLS PSI IS SLR KD Sbjct: 1 MFGFIPVAKITSSALYSPASVTTFSTLSSPSIFIVISCSLRFTCFFSFSSKISVTSLSKD 60 Query: 61 LLRILSPLTIIVTLFPWATKASAISNPM 88 LLR LSPLTIIVT FPWA ASAIS PM Sbjct: 61 LLRTLSPLTIIVTFFPWAANASAISIPM 88 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.134 0.394 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21948931 Number of Sequences: 2977 Number of extensions: 470347 Number of successful extensions: 1332 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1330 Number of HSP's gapped (non-prelim): 2 length of query: 88 length of database: 189,106,746 effective HSP length: 52 effective length of query: 36 effective length of database: 157,985,422 effective search space: 5687475192 effective search space used: 5687475192 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 158 (66.0 bits)