BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs8959 1358152 1357907 -82 !not a gene! (82 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71108 hypothetical protein PH0638 - Pyrococcus horikoshii ... 75 2e-13 >pir||G71108 hypothetical protein PH0638 - Pyrococcus horikoshii >gi|3257046|dbj|BAA29729.1| (AP000003) 154aa long hypothetical protein [Pyrococcus horikoshii] Length = 154 Score = 74.5 bits (180), Expect = 2e-13 Identities = 40/66 (60%), Positives = 44/66 (66%) Query: 17 GTASGSSLIXXXXXXXXXXXXILSCMWRYSRISVLWTGMRSFDVMLSLSSLFILSATSSK 76 G S I ILSCM RYS +SVLWTG+ SF+VMLSLSSLFILSA SS+ Sbjct: 83 GMLSRFLFISSHFAVSSAASAILSCMCRYSSMSVLWTGISSFEVMLSLSSLFILSAISSR 142 Query: 77 SSTFLA 82 SSTFLA Sbjct: 143 SSTFLA 148 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.128 0.370 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13467672 Number of Sequences: 2977 Number of extensions: 234812 Number of successful extensions: 1202 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1201 Number of HSP's gapped (non-prelim): 1 length of query: 82 length of database: 189,106,746 effective HSP length: 54 effective length of query: 28 effective length of database: 156,788,448 effective search space: 4390076544 effective search space used: 4390076544 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 157 (65.6 bits)