BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs8959 1358152 1357907 -82 !not a gene!
         (82 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||G71108 hypothetical protein PH0638 - Pyrococcus horikoshii ...    75  2e-13

>pir||G71108 hypothetical protein PH0638 - Pyrococcus horikoshii
           >gi|3257046|dbj|BAA29729.1| (AP000003) 154aa long
           hypothetical protein [Pyrococcus horikoshii]
           Length = 154
           
 Score = 74.5 bits (180), Expect = 2e-13
 Identities = 40/66 (60%), Positives = 44/66 (66%)

Query: 17  GTASGSSLIXXXXXXXXXXXXILSCMWRYSRISVLWTGMRSFDVMLSLSSLFILSATSSK 76
           G  S    I            ILSCM RYS +SVLWTG+ SF+VMLSLSSLFILSA SS+
Sbjct: 83  GMLSRFLFISSHFAVSSAASAILSCMCRYSSMSVLWTGISSFEVMLSLSSLFILSAISSR 142

Query: 77  SSTFLA 82
           SSTFLA
Sbjct: 143 SSTFLA 148


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.325    0.128    0.370 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13467672
Number of Sequences: 2977
Number of extensions: 234812
Number of successful extensions: 1202
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1201
Number of HSP's gapped (non-prelim): 1
length of query: 82
length of database: 189,106,746
effective HSP length: 54
effective length of query: 28
effective length of database: 156,788,448
effective search space: 4390076544
effective search space used: 4390076544
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.7 bits)
S2: 157 (65.6 bits)