BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs9283 1265358 1265071 -96 !not a gene! (96 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71124 hypothetical protein PH0761 - Pyrococcus horikoshii ... 83 8e-16 >pir||B71124 hypothetical protein PH0761 - Pyrococcus horikoshii >gi|3257169|dbj|BAA29852.1| (AP000003) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 82.7 bits (201), Expect = 8e-16 Identities = 40/55 (72%), Positives = 44/55 (79%) Query: 1 MPILNRSIPPAIAKASTLEPKNLNIHLPTKANVSNVTRTVIDTFSATSCLLSGAK 55 +PILNRSIPPAIAKAS LEPKNLNIH PT A V +TVI+TF ATSCL+S K Sbjct: 57 IPILNRSIPPAIAKASILEPKNLNIHCPTSAKTVRVMKTVIETFLATSCLISAGK 111 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.314 0.127 0.368 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34683452 Number of Sequences: 2977 Number of extensions: 1184071 Number of successful extensions: 2814 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2813 Number of HSP's gapped (non-prelim): 1 length of query: 96 length of database: 189,106,746 effective HSP length: 55 effective length of query: 41 effective length of database: 156,189,961 effective search space: 6403788401 effective search space used: 6403788401 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (22.0 bits) S2: 158 (66.0 bits)