BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs9317 1255392 1255192 -67 !not a gene! (67 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71124 hypothetical protein PH0767 - Pyrococcus horikoshii ... 106 4e-23 >pir||H71124 hypothetical protein PH0767 - Pyrococcus horikoshii >gi|3257175|dbj|BAA29858.1| (AP000003) 272aa long hypothetical protein [Pyrococcus horikoshii] Length = 272 Score = 106 bits (261), Expect = 4e-23 Identities = 52/60 (86%), Positives = 57/60 (94%) Query: 8 ASFNPLLSSSSAVKTPGPPALVIIATLLPLGRGCVNALAMLSISSMVFATKTPLCLNAAS 67 A+FNP LSSSSAV+TPGPPALVI+ATL PLG+GC NALAMLSISS+VFATKTPLCLNAAS Sbjct: 2 ANFNPRLSSSSAVRTPGPPALVIMATLFPLGKGCENALAMLSISSIVFATKTPLCLNAAS 61 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.131 0.372 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21208466 Number of Sequences: 2977 Number of extensions: 586117 Number of successful extensions: 1683 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1682 Number of HSP's gapped (non-prelim): 1 length of query: 67 length of database: 189,106,746 effective HSP length: 46 effective length of query: 21 effective length of database: 161,576,344 effective search space: 3393103224 effective search space used: 3393103224 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 156 (65.2 bits)