BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs9319 1254840 1254658 -61 !not a gene! (61 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71124 hypothetical protein PH0767 - Pyrococcus horikoshii ... 92 7e-19 >pir||H71124 hypothetical protein PH0767 - Pyrococcus horikoshii >gi|3257175|dbj|BAA29858.1| (AP000003) 272aa long hypothetical protein [Pyrococcus horikoshii] Length = 272 Score = 92.1 bits (225), Expect = 7e-19 Identities = 43/61 (70%), Positives = 46/61 (74%) Query: 1 MKVAFKSAWVFIIPTQLGPIILIPYLWAISTNXXXXXXXXXXXXXNPAVIITTPLTPFSP 60 +KVAFKS WVFIIPTQ GP+ILIPYLWAIST+ NPAVIITTPLTPFSP Sbjct: 179 IKVAFKSTWVFIIPTQFGPMILIPYLWAISTSSFSSLFPSSPVSPNPAVIITTPLTPFSP 238 Query: 61 H 61 H Sbjct: 239 H 239 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.141 0.468 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19263321 Number of Sequences: 2977 Number of extensions: 416835 Number of successful extensions: 525 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 524 Number of HSP's gapped (non-prelim): 1 length of query: 61 length of database: 189,106,746 effective HSP length: 40 effective length of query: 21 effective length of database: 165,167,266 effective search space: 3468512586 effective search space used: 3468512586 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 156 (65.2 bits)