BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs9526 1189784 1189620 -55 !not a gene! (55 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71082 hypothetical protein PH0924 - Pyrococcus horikoshii ... 79 5e-15 >pir||F71082 hypothetical protein PH0924 - Pyrococcus horikoshii >gi|3257337|dbj|BAA30020.1| (AP000004) 128aa long hypothetical protein [Pyrococcus horikoshii] Length = 128 Score = 79.2 bits (192), Expect = 5e-15 Identities = 37/53 (69%), Positives = 42/53 (78%) Query: 1 MPIFKVNSGVIFSLAIPLTPKVPNSFPISLPPEVILEPNYVVFSKVLTYLRLY 53 +PIF NSGVIFSLAIPLTPKVP SFP+ PP ++L+P YVVFSKV YL Y Sbjct: 50 IPIFIANSGVIFSLAIPLTPKVPKSFPMLSPPVIVLKPYYVVFSKVFAYLGFY 102 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.147 0.435 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21653821 Number of Sequences: 2977 Number of extensions: 690433 Number of successful extensions: 2185 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2184 Number of HSP's gapped (non-prelim): 1 length of query: 55 length of database: 189,106,746 effective HSP length: 34 effective length of query: 21 effective length of database: 168,758,188 effective search space: 3543921948 effective search space used: 3543921948 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 156 (65.2 bits)