BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs9645 1161375 1161178 -66 !not a gene! (66 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B72562 hypothetical protein APE1780 - Aeropyrum pernix (str... 69 5e-12 >pir||B72562 hypothetical protein APE1780 - Aeropyrum pernix (strain K1) >gi|5105470|dbj|BAA80783.1| (AP000062) 255aa long hypothetical protein [Aeropyrum pernix] Length = 255 Score = 69.1 bits (166), Expect = 5e-12 Identities = 37/55 (67%), Positives = 40/55 (72%) Query: 1 MGFLANASGVASSSGLYLFHSPSLPLNVGTPLSALIPAPVNAIAFFEEAKTLATS 55 +G L NASGVA S G L H+PSLPL VG PLSALIPAPVNA A E A+ LA S Sbjct: 150 LGSLLNASGVARSRGSNLLHNPSLPLKVGIPLSALIPAPVNATANLELARILADS 204 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.132 0.364 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22876966 Number of Sequences: 2977 Number of extensions: 771361 Number of successful extensions: 1253 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1252 Number of HSP's gapped (non-prelim): 1 length of query: 66 length of database: 189,106,746 effective HSP length: 45 effective length of query: 21 effective length of database: 162,174,831 effective search space: 3405671451 effective search space used: 3405671451 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (22.0 bits) S2: 156 (65.2 bits)