BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs9663 1157195 1156926 -90 !not a gene! (90 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|11500021 hypothetical conserved protein [Archaeoglobus fulgidus] 71 2e-12 pir||B72497 hypothetical protein APE2616 - Aeropyrum pernix (str... 67 4e-11 >gi|11500021 hypothetical conserved protein [Archaeoglobus fulgidus] Length = 144 Score = 71.0 bits (171), Expect = 2e-12 Identities = 32/74 (43%), Positives = 49/74 (65%) Query: 3 KDRAFIIAEEVFNSVNFIEDYEIYELAFLIAFETGCRAIDSFYIATAKVRDAILVSNDRA 62 K A + E + V I+ + E+AF + ETGCRAID+++IATAK+ ++ L++NDR Sbjct: 58 KSEAITLYEGIVXKVKLIDFAVLNEVAFSVCLETGCRAIDAYFIATAKLANSTLITNDRI 117 Query: 63 QVESARKFGVNAFY 76 E+ARK G+ A+Y Sbjct: 118 MAENARKAGIEAYY 131 >pir||B72497 hypothetical protein APE2616 - Aeropyrum pernix (strain K1) >gi|5106323|dbj|BAA81634.1| (AP000064) 141aa long hypothetical protein [Aeropyrum pernix] Length = 141 Score = 67.1 bits (161), Expect = 4e-11 Identities = 30/73 (41%), Positives = 49/73 (67%) Query: 4 DRAFIIAEEVFNSVNFIEDYEIYELAFLIAFETGCRAIDSFYIATAKVRDAILVSNDRAQ 63 ++A I + VN + + E+++ A IA TGCRA+D+++IATAK D IL++ND+ Sbjct: 59 EQALRIVDTTLKHVNVVREEELHDKAAEIALITGCRAVDAYFIATAKHVDGILITNDKVM 118 Query: 64 VESARKFGVNAFY 76 ++A+K GV A+Y Sbjct: 119 KDNAQKIGVKAYY 131 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.139 0.387 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21600180 Number of Sequences: 2977 Number of extensions: 578130 Number of successful extensions: 1409 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1407 Number of HSP's gapped (non-prelim): 2 length of query: 90 length of database: 189,106,746 effective HSP length: 53 effective length of query: 37 effective length of database: 157,386,935 effective search space: 5823316595 effective search space used: 5823316595 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 158 (66.0 bits)