BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs9883 1097433 1097230 -68 !not a gene! (68 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71071 hypothetical protein PH1261 - Pyrococcus horikoshii ... 95 1e-19 >pir||A71071 hypothetical protein PH1261 - Pyrococcus horikoshii >gi|3257680|dbj|BAA30363.1| (AP000005) 103aa long hypothetical protein [Pyrococcus horikoshii] Length = 103 Score = 94.8 bits (232), Expect = 1e-19 Identities = 45/61 (73%), Positives = 54/61 (87%) Query: 8 PTIELIIDRTRKAYLQLRVKATGTTMRGVMPEPIAGPTMKNPRAEPFLSLKSSLIKAVAG 67 PTIELII+RTRK LQL ++ATGTT++GV+PEPIAGP +K P+AEPF SLKSSLI+ VAG Sbjct: 43 PTIELIIERTRKESLQLSIRATGTTIKGVIPEPIAGPIIKKPKAEPFFSLKSSLIREVAG 102 Query: 68 A 68 A Sbjct: 103 A 103 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.133 0.364 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21591792 Number of Sequences: 2977 Number of extensions: 610944 Number of successful extensions: 1361 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1360 Number of HSP's gapped (non-prelim): 1 length of query: 68 length of database: 189,106,746 effective HSP length: 47 effective length of query: 21 effective length of database: 160,977,857 effective search space: 3380534997 effective search space used: 3380534997 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)