>r_klactV2381 Some similarity with CA1107 IPF11271 by homology to S. cerevisiae: ATP19 subunit K of the dimeric form of mitochondrial F1F0-ATP synthase MGAAYKIFGMTVQPHILAIATLGSVFGGAAYAMSGSKDAEKAKPAVATPAAPAAGGSDEFDVEKLLGDFLKEESK
InterPro data version 43.1 Hmmer 3.1b2
Switch on the InterPro lookup for results Show GO terms if iprlookup option is also given Don't perform CRC64 check
DataBase administrator