>r_klactVI4921 Highly similar to YDR045c SP|Q04307 RPC11 RNA polymerase III subunit C11, required for RNA cleavage activity and transcription termination singleton MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGAWDNVDQTAAQCPNHDQCAGE RAYFFQLQIRSADEPMTTFYKCVNCGHKWREN
InterPro data version 43.1 Hmmer 3.1b2
Switch on the InterPro lookup for results Show GO terms if iprlookup option is also given Don't perform CRC64 check
DataBase administrator