Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
>PAB1727 Hypothetical protein
MSKALELFMERASIHEDIVNAIKELSSKSLKEILSYALSGELDSTKVYEFLYENLPDGYPREKFKEFIEMERDHDRKVEK
IFRALFPGEEPVEVKLKTWSKAVLEKDFRLRTVKDYLKAPEIAMDLEKLSEGVYTMLYDILRNPEHKRIMKKLAEDERYH
YNFLRKEYDFYSQIEAEKALKELIRELKGNKGG
Supplementary options
Additional orf sequence dataSee Genomic Environment
Search GenBank with PSI-Blast at NCBISearch Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGESearch CDD Database at LBMGE
Determine COG functional Category (microbial)Determine COG functional Category (eukarial)
See this orf in P. abyssi Data Base
__________ GenBank id: 14521174 Gene name: - COG: S COG1633 Uncharacterized conserved protein Taxon: 272844 Lineage: Archaea: Euryarchaeota: Thermococci: Thermococcales: Thermococcaceae: Pyrococcus: Pyrococcus abyssi: Pyrococcus abyssi GE5
__________