Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
>PAB7080 rps14P SSU ribosomal protein S14P
MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKYE
Supplementary options
Additional orf sequence dataSee Genomic Environment
Search GenBank with PSI-Blast at NCBISearch Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGESearch CDD Database at LBMGE
Determine COG functional Category (microbial)Determine COG functional Category (eukarial)
See this orf in P. abyssi Data Base
__________ GenBank id: 14520543 Gene name: rps14P COG: J COG0199 Ribosomal protein S14 Taxon: 272844 Lineage: Archaea: Euryarchaeota: Thermococci: Thermococcales: Thermococcaceae: Pyrococcus: Pyrococcus abyssi: Pyrococcus abyssi GE5
__________