Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
>MTH432 hypothetical protein MTH432 
MRSAVLYSGGKDSTMALYHALQESEVEFLVSVISDNPESHMYHVPNIHLTALLAEAVGIPLIESRTAGVEEEEVEDLAGT
LKTLRERGVEAVYSGALYSEYQKSRIDSICRRLGLRSVAPLWHRDPLDYMEEIVDLGFRVMVTAVAAEGLDESWLGRIVD
RKMIDELADLSERYGINPAFEGGEAESLVLDGPIFKKRLEILEYEKKWFFDNGFLDIKRAVLVDKD
Supplementary options
Additional orf sequence dataSee Genomic Environment
Search GenBank with PSI-Blast at NCBISearch Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGESearch CDD Database at LBMGE
Determine COG functional Category (microbial)Determine COG functional Category (eukarial)
__________ GenBank id: 15678460 Gene name: - COG: R COG2102 Predicted ATPases of PP-loop superfamily Taxon: 187420 Lineage: Archaea: Euryarchaeota: Methanobacteria: Methanobacteriales: Methanobacteriaceae: Methanothermobacter: Methanothermobacter thermautotrophicus: Methanothermobacter thermautotrophicus str. Delta H
__________