ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
SSO1088  suspect: LH  S        COG1716  Function unknown                                             Uncharacterized BCR
Only best alignment is shown:
BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SSO1088 944603 945229 209 DE: hypothetical
         (209 letters)

Database: COG data base
           28,141 sequences; 9,541,151 total letters

Align with Genomapper Align with Multalin Get Orfs Sequences Get Orfs Sequences (no defs) Align with Mulalbla  

Toggle selected groups						Display and select lineage
ALL	BACTERIA	ARCHAEA	EUKARYA	VIRUSES		Toggle Lineage display	Expand tree	Collapse tree	Show full lineage

 
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value


Rv1827 S COG1716                                                      46  2e-05

>Rv1827 S COG1716
           Length = 162
           
 Score = 46.1 bits (107), Expect = 2e-05
 Identities = 22/44 (50%), Positives = 28/44 (63%)

Query: 132 SIGRSPENVIVIPDPEVSRKHAIISFENNELYLEDLNSTNGTYV 175
           S GR P++ I + D  VSR+HA    ENNE  + D+ S NGTYV
Sbjct: 78  SAGRHPDSDIFLDDVTVSRRHAEFRLENNEFNVVDVGSLNGTYV 121


  Database: COG data base
    Posted date:  Jul 31, 2000 12:49 AM
  Number of letters in database: 9,541,151
  Number of sequences in database:  28,141
  
Lambda     K      H
   0.314    0.132    0.387 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2983364
Number of Sequences: 28141
Number of extensions: 109706
Number of successful extensions: 233
Number of sequences better than 1.0e-04: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 232
Number of HSP's gapped (non-prelim): 1
length of query: 209
length of database: 9,541,151
effective HSP length: 49
effective length of query: 160
effective length of database: 8,162,242
effective search space: 1305958720
effective search space used: 1305958720
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 42 (22.0 bits)
S2: 101 (43.8 bits)