Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus acidocaldarius DSM 639.
>Saci_1537 DNA polymerase II 
MSKQATLFDFSIKKNESKEQTNQESVEVPKQTANRTKIEWIKEAEDGKVYFLLQVDYDGKKSRAVCKLYDKEGKKIYIMQ
DESGHKPYFLTDIDPDKVNKITKVVRDPSFDHLELINKVDPYTGKKIRLTKIVVKDPLAVRRMRSSLPKAYEAHIKYYNN
YVYDNGLIPGLIYKVNKGKLTQLNPELKGEEINEIKKAFADADEMTKETVNDWIPILETEVPDIKRVSLDIEVYTPNRGR
IPDPERAEFPIISVALAGNDGSKIVLALKREDVNSDFSKKDGVQVEIFDSEKKLLARLFEIIREYPMLLTFNGDDFDIPY
IYFRALRLNFSPEEVPLDVVSGEGKFLAGIHIDLYKFFFNRAVRIYAFEGKYSEYSLDAVATALLGISKVKLDTFISFLD
IDKLIEYNLRDAEITLKLTTFNNNLVLKLMVLLARISKLGLEELTRTEVSTWIKNLYYWEHRKRNWLIPLKEEILVRSNQ
VKTAAVIKGKKYKGAVVIDPPAGVYFNVVVLDFASLYPSIIKNWNISYETIDIDECTKKVWVEDETGEKLHYVCMDKPGI
TAVITGLIRDFRVKVYKKKAKYSNISEEQRSLYDVVQRAMKVFINATYGVFGAENFPLYAPAVAESVTAIGRYIITTTYK
QAEKLNLKVIYGDTDSLFLYNPTKDKLEELIKFVKQNFNLDLEVDKSYKYVAFSGLKKNYFGVYPDGKTEIKGMLAKKRN
TPEFIKKEFAEIKNMLASLNSPNDIPEVKNKLEIKIKDIYNKLRNKGYNLDDLAFRIMLSKPLDSYTKNTPQHVKAGLQL
RAFGVNVLPRDVIMFVKVKSKDGVKPIQLAKISEIDIEKYVETLRTTFEQILKAFGISWDEIVSTISIDSFFGSKK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 70607274 Gene name: dpo1 COG: L COG0417 DNA polymerase elongation subunit (family B) Taxon: 330779 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus acidocaldarius: Sulfolobus acidocaldarius DSM 639
__________