Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus islandicus REY15A
>SiRe_1231 hypothetical protein
MVSAKDILSDSLRSSVLIIKHKDKLSPDYVPENLPHREEKIKELGFVFRDLLAGDAKDSERVVIVGRTGTGKTATVRLFG
KNFEDIAEREYGVKVKYVHVNCYRHRTLYLISQEIANALKLPIPSRGLSAQEVFKIIHEYLDRRNIHLIVALDEFGHFLN
TANTEEIYFLVRLYDEISAIIKRISYIFIVNESHSIYKLDRSIRDHIARRLIEFPPYRSMELYDILKYRVDEAFNDNAVD
DEVLQFISNTYGYDKGGNGNARIAIETLSLAGEIAEKEGSPVVLLDHAKKANSTINPEIQEIVDSLSYLDLHQLILLKAL
IRVLNKSKADEVTMGTLEEEYISLAREFNEEPRRHTQVYEYLRKLKVIGIINTRQSGKGMRGRTTLVSLSLPLDKRLDDY
IMQQIVVRLKSKA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 385775944 Gene name: - COG: Taxon: 930945 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus islandicus: Sulfolobus islandicus REY15A
__________