Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Schizosaccharomyces pombe chromosome I
>SPAP14E8.05c hypothetical protein SPAP14E8.05c 
MTPDQNALVLSFLLTVGGLIGYLRKKSKVSLIAGTALGANFAWASKLMERGSSQGINYAFYGSLVLLASSGPRFYKSRKP
VPMILTVLGVISTWYFYRLWA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 19114453 Gene name: - COG: S COG5548 Small integral membrane protein Taxon: 284812 Lineage: Eukaryota: Opisthokonta: Fungi: Dikarya: Ascomycota: Taphrinomycotina: Schizosaccharomycetes: Schizosaccharomycetales: Schizosaccharomycetaceae: Schizosaccharomyces: Schizosaccharomyces pombe: Schizosaccharomyces pombe 972h-
__________