Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Schizosaccharomyces pombe chromosome III
>SPCP31B10.08c hypothetical protein SPCP31B10.08c 
MPAQGHRLYVKAKHLSFQRSKHVIHPGTSIVKIEGCDSKEEAQFYLGKRVCYVYKSSKAVRGSKIRVIWGTIARPHGNSG
AVRARFVHNLPAKTFGSSLRVMLYPSNI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 19075364 Gene name: - COG: J COG2451 Ribosomal protein L35AE/L33A Taxon: 284812 Lineage: Eukaryota: Opisthokonta: Fungi: Dikarya: Ascomycota: Taphrinomycotina: Schizosaccharomycetes: Schizosaccharomycetales: Schizosaccharomycetaceae: Schizosaccharomyces: Schizosaccharomyces pombe: Schizosaccharomyces pombe 972h-
__________