Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
>SSO10889 52 aa !not a gene!
MIPNLLLVIILDLRMVDNGTPSSYSLLIRVKFIVKLILKITIPPINRPRSNA
Supplementary options
Additional orf sequence dataSee Genomic Environment
Search GenBank with PSI-Blast at NCBISearch Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGESearch CDD Database at LBMGE
Determine COG functional Category (microbial)Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 100000128756 Gene name: - COG: Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________