Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Saccharomyces cerevisiae chromosome II
>YBL027W Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Ap and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal 
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSKSRTRAHAQSKREGRHSGYGK
RKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAE
ARRLKNRAARDRRAQRVAEKRDALLKEDA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 6319444 Gene name: RPL19B COG: J COG2147 Ribosomal protein L19E Taxon: 4932 Lineage: Eukaryota: Opisthokonta: Fungi: Dikarya: Ascomycota: saccharomyceta: Saccharomycotina: Saccharomycetes: Saccharomycetales: Saccharomycetaceae: Saccharomyces: Saccharomyces cerevisiae
__________