Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome IV >YDL120W Frataxin, regulates mitochondrial iron accumulation; interacts with Isu1p which promotes Fe-S cluster assembly; interacts with electron transport chain components and may influence respiration; human homolog involved in Friedrich′s ataxia MIKRSLASLVRVSSVMGRRYMIAAAGGERARFCPAVTNKKNHTVNTFQKRFVESSTDGQVVPQEVLNLPLEKYHEEADDY LDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTD ILTEEVEKAISKSQ