Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Saccharomyces cerevisiae chromosome IV
>YDL136W Protein component of the large (60S) ribosomal subunit, identical to Rpl35Ap and has similarity to rat L35 ribosomal protein 
MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIACVLTVINEQQREAVRQLYKGKKYQPKDL
RAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIKA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 6320065 Gene name: RPL35B COG: J COG0255 Ribosomal protein L29 Taxon: 4932 Lineage: Eukaryota: Opisthokonta: Fungi: Dikarya: Ascomycota: saccharomyceta: Saccharomycotina: Saccharomycetes: Saccharomycetales: Saccharomycetaceae: Saccharomyces: Saccharomyces cerevisiae
__________