Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Saccharomyces cerevisiae chromosome IV
>YDR397C Beta subunit of the NC2 dimeric histone-fold complex; represses RNA polymerase II transcription through binding to TBP and inhibition of TFIIA and TFIIB; homologous to the Dr1 subunit of the mammalian NC2 (negative cofactor2) 
MAGDSDNVSLPKATVQKMISEILDQDLMFTKDAREIIINSGIEFIMILSSMASEMADNEAKKTIAPEHVIKALEELEYNE
FIPFLEEILLNFKGSQKVKETRDSKFKKSGLSEEELLRQQEELFRQSRSRLHHNSVSDPVKSEDSS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 6320605 Gene name: NCB2 COG: K COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) Taxon: 4932 Lineage: Eukaryota: Opisthokonta: Fungi: Dikarya: Ascomycota: saccharomyceta: Saccharomycotina: Saccharomycetes: Saccharomycetales: Saccharomycetaceae: Saccharomyces: Saccharomyces cerevisiae
__________