Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome IV >YDR397C Beta subunit of the NC2 dimeric histone-fold complex; represses RNA polymerase II transcription through binding to TBP and inhibition of TFIIA and TFIIB; homologous to the Dr1 subunit of the mammalian NC2 (negative cofactor2) MAGDSDNVSLPKATVQKMISEILDQDLMFTKDAREIIINSGIEFIMILSSMASEMADNEAKKTIAPEHVIKALEELEYNE FIPFLEEILLNFKGSQKVKETRDSKFKKSGLSEEELLRQQEELFRQSRSRLHHNSVSDPVKSEDSS