Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome IV >YDR441C Apparent pseudogene, not transcribed or translated under normal conditions; encodes a protein with similarity to adenine phosphoribosyltransferase, but artificially expressed protein exhibits no enzymatic activity MSISESYAKEIKTAFRQFTDFPIEGEQFEDFLPIIGNPTLFQKLVHTFKTHLEEKFGKEKIDFIAGIEARGLLFGPSLAL ALGVGFVPIRRVGKLPGECASITFTKLDHEEIFEMQVEAIPFDSNVVVVDDVLATGGTAYAAGDLIRQVGAHILEYDFVL VLDSLHGEEKLSAPIFSILHS