Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome VI >YFR032C-A Protein component of the large (60S) ribosomal subunit, has similarity to rat L29 ribosomal protein; not essential for translation, but required for proper joining of the large and small ribosomal subunits and for normal translation rate MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTAKALAAAKK