Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome VII >YGR181W Mitochondrial intermembrane space protein, forms a complex with TIm8p that mediates import and insertion of a subset of polytopic inner membrane proteins; may prevent aggregation of incoming proteins in a chaperone-like manner MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELVNKISENCFEKCLTSPYATRNDACIDQCLAK YMRSWNVISKAYISRIQNASASGEI