Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome VII >YGR203W Putative protein with sequence similarity to protein tyrosine phosphatases of the CDC25-like phosphatase family; green fluorescent protein (GFP)-fusion protein localizes to both the cytoplasm and the nucleus MDSYSITNVKYLDPTELHRWMQEGHTTTLREPFQVVDVRGSDYMGGHIKDGWHYAYSRLKQDPEYLRELKHRLLEKQADG RGALNVIFHCMLSQQRGPSAAMLLLRSLDTAELSRCRLWVLRGGFSRWQSVYGDDESVTAGYLPDLWR