Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Saccharomyces cerevisiae chromosome XI
>YKL019W Alpha subunit of both the farnesyltransferase and type I geranylgeranyltransferase that catalyze prenylation of proteins containing a CAAX consensus motif; essential protein required for membrane localization of Ras proteins and a-factor 
MEEYDYSDVKPLPIETDLQDELCRIMYTEDYKRLMGLARALISLNELSPRALQLTAEIIDVAPAFYTIWNYRFNIVRHMM
SESEDTVLYLNKELDWLDEVTLNNPKNYQIWSYRQSLLKLHPSPSFKRELPILKLMIDDDSKNYHVWSYRKWCCLFFSDF
QHELAYASDLIETDIYNNSAWTHRMFYWVNAKDVISKVELADELQFIMDKIQLVPQNISPWTYLRGFQELFHDRLQWDSK
VVDFATTFIGDVLSLPIGSPEDLPEIESSYALEFLAYHWGADPCTRDNAVKAYSLLAIKYDPIRKNLWHHKINNLN

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 6322833 Gene name: RAM2 COG: O COG5536 Protein prenyltransferase, alpha subunit Taxon: 4932 Lineage: Eukaryota: Opisthokonta: Fungi: Dikarya: Ascomycota: saccharomyceta: Saccharomycotina: Saccharomycetes: Saccharomycetales: Saccharomycetaceae: Saccharomyces: Saccharomyces cerevisiae
__________