Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome XII >YLR406C Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Ap and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTEDVRLAPELNQAIWKRGVKGVEYRLRLRISRKRN EEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA