Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome XIII >YMR035W Catalytic subunit of the mitochondrial inner membrane peptidase complex, required for maturation of mitochondrial proteins of the intermembrane space; complex contains Imp1p and Imp2p (both catalytic subunits), and Som1p MFRAGSSKRFLRNTLIAISWVPVLLTINNNVVHIAQVKGTSMQPTLNPQTETLATDWVLLWKFGVKNPSNLSRDDIILFK APTNPRKVYCKRVKGLPFDTIDTKFPYPKPQVNLPRGHIWVEGDNYFHSIDSNTFGPISSGLVIGKAITIVWPPSRWGTD LKLSTGRDCISKRAILE