Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome XV >YOL127W Primary rRNA-binding ribosomal protein component of the large (60S) ribosomal subunit, has similarity to E. coli L23 and rat L23a ribosomal proteins; binds to 26S rRNA via a conserved C-terminal motif MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETAMKKVEDGN ILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI