Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome XVI >YPL143W N-terminally acetylated ribosomal protein L37 of the large (60S) ribosomal subunit, nearly identical to Rpl33Bp and has similarity to rat L35a; rpl33a null mutant exhibits slow growth while rpl33a rpl33b double null mutant is inviable MAESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAYVYRASKEVRGSKIRVMWGKVTRTHGNSGV VRATFRNNLPAKTFGASVRIFLYPSNI