Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer |
Saccharomyces cerevisiae chromosome XVI >YPL249C-A Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Ap and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA MAVKTGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSF TRAKAKVEEMNNIIAASRRH