Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0006 hypothetical protein SSO0006 
MKITFIGTGAGSSLGLKRVKSSILINDKVLLDLGPGAELRLEDLRIHPKALFITHLHIDHFSGVFDYLVQRKIRQIPELV
IYSPKGFSEVLNIYTRIGNNISAKIYESDLPSGKIDEMEIYSIQACHSIYAVSYIISDGNTRVLYTGDTKEPCNAILENI
KDVDLIIHETTCVDDCSIWGHTSIKQIFELFSNKRIFATHIPAEIEEKIISLANNKINIAFDGLSLNV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15896976 Gene name: - COG: R COG1234 Metal-dependent hydrolases of the beta-lactamase superfamily III Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0006 hypothetical 1 Conserved hypothetical protein 1 putative Present in archaea and some bacteria and eukarya, including M. jannaschii, E. coli, B. subtilus, yeast, and human. 04/22/01 00:00:00 terminal status:good R COG1234 General function prediction only Metal-dependent hydrolases of the beta-lactamase superfamily III

CROSS REFERENCES:
pI: 6,31
MW: 25533,14
GenBank: 13813131
SCOP superfamily: => 
SCOP assignment: 1-206 1.4e-19 Metallo-hydrolase