Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0072 30S ribosomal protein S11 
MSSRREIRWGIAHIYASQNNTLLTISDLTGAEIISRASGGMVVKADREKSSPYAAMLAANKAASDALEKGIMALHIKVRA
PGGYGSKTPGPGAQPAIRALARAGFIIGRIEDVTPIPHDTIRRPGGRRGRRV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897039 Gene name: rps11AB COG: J COG0100 Ribosomal protein S11 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0072 confirmed 1 rps11AB SSU ribosomal protein S11AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0100 Translation, ribosomal structure and biogenesis Ribosomal protein S11

CROSS REFERENCES:
pI: 11,71
MW: 14041,04
GenBank: 13813204