Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0082 N-terminal acetyltransferase complex ard1 subunit 
MVIITDATEADLDQIFQIETESFEDPYPYSLLRAYLFLANKLYLVAKQREKVVGYIIGIIQYGYRGHIVSIAVEPIYRKQ
GIGAKLLNEIEERFKLNGARYSYLEVNTNNLSAISFYRANGYLIMYVRKNYYGRDKHAFVMVKNLYYKYLD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897047 Gene name: - COG: R COG0456 Acetyltransferases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0082 hypothetical 2 N-terminal acetyltransferase complex ard1 subunit Protein modification 1 single function 2.3.1.128 04/22/01 00:00:00 terminal status:good R COG0456 General function prediction only Acetyltransferases

CROSS REFERENCES:
pI: 9,78
MW: 17742,32
GenBank: 13813214
SCOP superfamily: => 
SCOP assignment: 1-145 5.0e-33 Acyl-CoA N-acyltransferases (Nat)