Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0220 transcription elongation factor NusA 
MTRANVRDCIIDNENNRIIFLVDSKDMGVAIGKSGINVKKLKKIIGKDIELVAYSDNLEELVKNLMSPARVRSVKVVNTS
SKKSVYINIDPQDKGLAIGKNGRNVARAKLILKRYMDIDNVVIV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897168 Gene name: nusA COG: K COG0195 Transcription elongation factor Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0220 hypothetical 1 nusA Transcription termination factor nusA homolog, putative Transcription 1 single function RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG0195 Transcription Transcription terminator NusA

CROSS REFERENCES:
pI: 10,61
MW: 13812,13
GenBank: 13813357
SCOP superfamily: => 
SCOP assignment: 18-62 3.8e-03 KH-domain